PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010092813.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family G2-like
Protein Properties Length: 368aa    MW: 41304.8 Da    PI: 9.784
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010092813.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like993.4e-3169122255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     prlrW p+LH rFv+ave+LGG+e+AtPk +l+lm++kgL+++hvkSHLQ+YR+
  XP_010092813.1  69 PRLRWMPDLHLRFVHAVERLGGQERATPKLVLQLMNIKGLSIAHVKSHLQMYRS 122
                     8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.77765125IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-2865123IPR009057Homeodomain-like
SuperFamilySSF466893.4E-1366123IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-2169124IPR006447Myb domain, plants
PfamPF002491.0E-770121IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MKGSISNSEC SKTTLSNQNN GESESGENDD DQISKPNKNN GGLSSSNSTV EESSEKKSSV  60
RPYVRSKAPR LRWMPDLHLR FVHAVERLGG QERATPKLVL QLMNIKGLSI AHVKSHLQMY  120
RSKKIDDAGQ VLADHRHLVE YGDRNIYNLS QLPMLQGYNQ RHNSSFRYGF DDPSWSSYGN  180
LRQYPRSDGF YGTTIFGSTT TSNWSSTIPC SFPTRNNTIS SLITENSAWK THNKQKNDHQ  240
SPRPQTRLSI PNDLNAVKHL QAVNNAPRES DSVTTIQEQS KNLKRKASDC GENLDLELSL  300
RLTSRNNVMD HKKKERSAFG EDEVDSSLSL SLSSNPSSKP IRRLKEQAAD SSCKEMNGKR  360
TSTLDLTI
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00297DAPTransfer from AT2G38300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010092813.10.0Putative Myb family transcription factor
TrEMBLW9R2E60.0W9R2E6_9R
STRINGPOPTR_0016s12940.11e-87(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23783482
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.13e-59G2-like family protein